PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10012104
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 759aa    MW: 81312.2 Da    PI: 8.98
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10012104genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.66.6e-14243302362
                  XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                  + k+  r+++NRe+A+ sRqRKk ++eeLe+kv ++ +  ++L  +++    e a+l+ +
  Lus10012104 243 DEKKKARLMRNRESAQLSRQRKKHYVEELEDKVRAMHSTITDLNGKISYFMAENASLRHQ 302
                  669999**************************************9999999999998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.0E-15241305IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.151243303IPR004827Basic-leucine zipper domain
PfamPF001703.1E-12244302IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.38E-12245303No hitNo description
Gene3DG3DSA:1.20.5.1701.1E-16245303No hitNo description
CDDcd147042.63E-21246297No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 759 aa     Download sequence    Send to blast
MNTSLLGCFI VCVKQTATRC LLPSSFFLFN IXXXXKTVAA PPVDPVGFFT SDHDVGGGLA  60
SDLNSFNFDE NFDIGIDFDD LDSLYFPSET ESFLLPDSSP AGSPNNDSAA AAAESENSGV  120
SGDVVGKYFN CDSDEGSTAM AAANCRVDSS PASSHGSGNG RSTVSDTEAA CCSPDSGSSE  180
KKKKNVVKDE GEGNAKRKKE SGNGEQLRRQ KCRVLEFPSS VSKESDDSKA ESGSVGQQFG  240
GEDEKKKARL MRNRESAQLS RQRKKHYVEE LEDKVRAMHS TITDLNGKIS YFMAENASLR  300
HQLGGGNGGM CPPPGMYPPP MTPMPYPWMP CAPYVIKPQG SQVPLVPIPR LKPQQHQQQP  360
APKSKKGTGE GKRSETRTKK VASVSFLGLL FFVLMFGGLV PLVNVKYGGV SDSNDAVNKW  420
FGGSGGRFSD QNLPGRVLVV DGHSNRTRGS INGGMHCEKG VKGRLECDKS REGGPKNVPK  480
GSGFTSTDNS TEQLHASLYV PRNDKLVKID GNLIIHSVLA SEKTKRSHAS ATSTEAKPKE  540
TSLAVSKYLS AALAIPDGTT RRRLYRTTTE QQKAIGGSRS ADNLKEQFKS SAADGKLQQW  600
FHQGLAGPML SSGVCSEVFQ FDVSPSPGAI VTASSVTNLT NKPQNATADH APPSDKKKHR  660
RILHGLPVPF STSDLNTTGD QHRQKGGQKN ETSYNNPAAA SSSMVVSVLV DPREVGDSDM  720
VAPKKSLSRV FVVVLVDSVK YVTYSCVLPR SGPHLVRA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1181198KKKNVVKDEGEGNAKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8879923e-79HQ887992.1 Linum usitatissimum clone GMU2AYZ01ABWC6 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012462424.10.0PREDICTED: bZIP transcription factor 17
TrEMBLA0A0D2V8N80.0A0A0D2V8N8_G
STRINGPOPTR_0016s03220.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74873448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.11e-108bZIP family protein